General Information

  • ID:  hor006935
  • Uniprot ID:  P10758
  • Protein name:  Lithostathine
  • Gene name:  CCL1; SCYA1;
  • Organism:  Rattus norvegicus
  • Family:  NA
  • Source:  Animal
  • Expression:  Expressed only in regenerating islets; but not in normal pancreatic islets; insulinomas or regenerating liver.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Rattus; Rattus norvegicus (Rat)
  • GO MF:  GO:0045178 basal part of cell; GO:0032590 dendrite membrane; GO:0005615 extracellular space; GO:0030426 growth cone; GO:0032809 neuronal cell body membrane; GO:0048471 perinuclear region of cytoplasm; GO:0032991 protein-containing complex; GO:0042588 zymogen granule
  • GO BP:  GO:0008083 growth factor activity; GO:0042802 identical protein binding; GO:0042834 peptidoglycan binding; GO:0070492 oligosaccharide binding; GO:0019902 phosphatase binding; GO:0019903 protein phosphatase binding; GO:0038023 signaling receptor activity; GO:0005102 signaling receptor binding; GO:0140678 molecular function inhibitor activity
  • GO CC:  GO:1990785 response to water-immersion restraint stress; GO:0010628 positive regulation of gene expression; GO:1903861 positive regulation of dendrite extension; GO:1990867 response to gastrin; GO:1990864 response to growth hormone-releasing hormone; GO:0001666 response to hypoxia; GO:0061844 antimicrobial humoral immune response mediated by antimicrobial peptide; GO:0031667 response to nutrient levels; GO:1990869 cellular response to chemokine; GO:1990878 cellular response to gastrin; GO:0010467 gene expression; GO:0097421 liver regeneration; GO:0007494 midgut development; GO:0008285 negative regulation of cell population proliferation; GO:1990798 pancreas regeneration; GO:0043491 phosphatidylinositol 3-kinase/protein kinase B signal transduction; GO:1904699 positive regulation of acinar cell proliferation; GO:0008284 positive regulation of cell population proliferation; GO:0014070 response to organic cyclic compound; GO:0043434 response to peptide hormone; GO:0003309 type B pancreati

Sequence Information

  • Sequence:  EAEEDLPSARITCPEGSNAYSSYCYYFMEDHLSWAEADLFCQNMNSGYLVSVLSQAEGNFLASLIKESGTTAANVWIGLHDPKNNRRWHWSSGSLFLYKSWDTGYPNNSNRGYCVSVTSNSGYKKWRDNSCDAQLSFVCKFKA
  • Length:  143
  • Propeptide:  MTRNKYFILLSCLMVLSPSQGQEAEEDLPSARITCPEGSNAYSSYCYYFMEDHLSWAEADLFCQNMNSGYLVSVLSQAEGNFLASLIKESGTTAANVWIGLHDPKNNRRWHWSSGSLFLYKSWDTGYPNNSNRGYCVSVTSNSGYKKWRDNSCDAQLSFVCKFKA
  • Signal peptide:  MTRNKYFILLSCLMVLSPSQG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life: Half-Life Yeast:
Half-Life E.Coli: Aliphatic Index
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA